PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g086590.2
Common NameMTR_1g086590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 433aa    MW: 49269.2 Da    PI: 8.2462
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g086590.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.56.5e-08115157346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT+eE ++l d+++++  + +  Ia +++  Rt +++k+r+++
  Medtr1g086590.2 115 KWTKEETDQLFDLCERFNLR-FIVIADRFPSSRTVEELKDRYYS 157
                      8******************9.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162829.4E-3188162IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007171.4E-7112161IPR001005SANT/Myb domain
SuperFamilySSF466897.01E-7113163IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-6114160IPR009057Homeodomain-like
CDDcd116587.76E-18116158No hitNo description
PfamPF054991.0E-7303366IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0032259Biological Processmethylation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008168Molecular Functionmethyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MDVKNILGGL PNFSFPLQEK NSSEVCALTG GFAPLMPAVD LSLLKKKPPS DKKVIWRWLP  60
FKNSARKDDL QLHHWIQVVN GVPPTGDYSF AKYNKSVDIT RYTDEEYEKY LANPKWTKEE  120
TDQLFDLCER FNLRFIVIAD RFPSSRTVEE LKDRYYSVSR AMLIARNPSS TDVAMDPLVQ  180
EPYNVSQEME RKRAQSLILS QTKQQERRDE EVLAEAKRIA ELRIMTKVDL ESELDVASKA  240
CANVTERANP GETVSPSNTE LPPIVVSSMT STDNASTIAS LRMLYVYSRT YALGQMVQSA  300
SSSAGLRTIK RVDQTLQELG VNLKPRVPTK TVCAEHLELR NEILTLLNLQ KQLQNKEVEG  360
SSFRDGSHCE TTGTPKRLHR GGDQDLTFVP DNTSSGGERI GKRDQKRKVW ICFFYFIMFK  420
YSFLFYMLLD QC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A4e-2187172493DNA methyltransferase 1-associated protein 1
4iej_A4e-2187172493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1249614e-89AC124961.19 Medicago truncatula clone mth2-18l7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003591366.20.0DNA methyltransferase 1-associated protein
SwissprotQ8VZL61e-173SWC4_ARATH; SWR1-complex protein 4
TrEMBLG7ICU60.0G7ICU6_MEDTR; DNA methyltransferase 1-associated protein
STRINGGLYMA19G40630.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.11e-156MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]